NUDT14 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2088993
Article Name: NUDT14 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088993
Supplier Catalog Number: orb2088993
Alternative Catalog Number: BYT-ORB2088993-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NUDT14
Conjugation: FITC
Alternative Names: UGPP, UGPPase
NUDT14 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 803877
UniProt: O95848
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNSSRRSLVLVKQFRPAV