NUBPL Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2088999
Article Name: NUBPL Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088999
Supplier Catalog Number: orb2088999
Alternative Catalog Number: BYT-ORB2088999-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUBPL
Conjugation: FITC
Alternative Names: IND1, huInd1, MC1DN21, C14orf127
NUBPL Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 079428
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVR