MRPS7 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Catalog Number:
BYT-ORB2089028
| Article Name: |
MRPS7 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2089028 |
| Supplier Catalog Number: |
orb2089028 |
| Alternative Catalog Number: |
BYT-ORB2089028-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS7 |
| Conjugation: |
HRP |
| Alternative Names: |
S7mt, MRP-S, RP-S7, RPMS7, MRP-S7, COXPD34, bMRP27a |
| MRPS7 Rabbit Polyclonal Antibody (HRP) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
27kDa |
| NCBI: |
057055 |
| UniProt: |
Q9Y2R9 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: QFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVP |
