MRPL32 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089031
Article Name: MRPL32 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089031
Supplier Catalog Number: orb2089031
Alternative Catalog Number: BYT-ORB2089031-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL32
Conjugation: HRP
Alternative Names: L32mt, HSPC283, MRP-L32, bMRP-59b
MRPL32 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 114109
UniProt: Q9BYC8
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: CYEKVCKETAEIRRQIGKQEGGPFKAPTIETVVLYTGETPSEQDQGKRII