MICAL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089045
Article Name: MICAL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089045
Supplier Catalog Number: orb2089045
Alternative Catalog Number: BYT-ORB2089045-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MICAL2
Conjugation: Biotin
Alternative Names: MICAL-2, MICALCL, Ebitein1, MICAL2PV1, MICAL2PV2
MICAL2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 86kDa
UniProt: O94851
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESS