LEKR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089063
Article Name: LEKR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089063
Supplier Catalog Number: orb2089063
Alternative Catalog Number: BYT-ORB2089063-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LEKR1
Conjugation: Biotin
Alternative Names: FLJ16641, FLJ37161
LEKR1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 001004316
UniProt: Q6ZMV7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FLQETVRRECEERFELTEALSQAREQLLELSKLRGSLPFSPCSLSKGSLT