KIAA0513 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089093
Article Name: KIAA0513 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089093
Supplier Catalog Number: orb2089093
Alternative Catalog Number: BYT-ORB2089093-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIAA0513
Conjugation: Biotin
KIAA0513 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 055547
UniProt: O60268
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NVKGFFGGLETKLKGPLARRNEEDENKPQEKRPRAVTAYSPEDEKKGEKI