CYB561D2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089267
Article Name: CYB561D2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089267
Supplier Catalog Number: orb2089267
Alternative Catalog Number: BYT-ORB2089267-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CYB561D2
Conjugation: Biotin
Alternative Names: 101F6, TSP10, XXcos-LUCA11.4
CYB561D2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 005264889
UniProt: O14569
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ALSAETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVL