CDH26 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089303
Article Name: CDH26 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089303
Supplier Catalog Number: orb2089303
Alternative Catalog Number: BYT-ORB2089303-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CDH26
Conjugation: Biotin
Alternative Names: VR20
CDH26 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 92kDa
NCBI: 817089
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VQVTDANDPPAFHPQSFIVNKEEGARPGTLLGTFNAMDPDSQIRYELVHD