Ccdc59 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089321
Article Name: Ccdc59 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089321
Supplier Catalog Number: orb2089321
Alternative Catalog Number: BYT-ORB2089321-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ccdc59
Conjugation: Biotin
Alternative Names: D10Ertd718, D10Ertd718e, 2300004H16Rik
Ccdc59 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 079878
UniProt: Q8R2N0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KRAAKKFEFEMRKQEREEAQRLYKKKKMEAFKILSKKTKKGQPNLNLQME