CCDC59 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089324
Article Name: CCDC59 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089324
Supplier Catalog Number: orb2089324
Alternative Catalog Number: BYT-ORB2089324-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC59
Conjugation: Biotin
Alternative Names: BR22, TAP26, HSPC128
CCDC59 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 054886
UniProt: Q9P031
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EPLFEDQCSFDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQA