C1orf49 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089350
Article Name: C1orf49 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089350
Supplier Catalog Number: orb2089350
Alternative Catalog Number: BYT-ORB2089350-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1orf49
Conjugation: FITC
Alternative Names: TSC24, C1orf49
C1orf49 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 115502
UniProt: Q5T0J7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR