ASB14 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089359
Article Name: ASB14 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089359
Supplier Catalog Number: orb2089359
Alternative Catalog Number: BYT-ORB2089359-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ASB14
Conjugation: FITC
Alternative Names: DKFZp313L0121
ASB14 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 569058
UniProt: A6NK59
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LELLIQAGFDVNFMLDQRINKHYDDHRKSALYFAVSNSDLSSVKLLLSAG