ARHGAP27 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089370
Article Name: ARHGAP27 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089370
Supplier Catalog Number: orb2089370
Alternative Catalog Number: BYT-ORB2089370-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARHGAP27
Conjugation: HRP
Alternative Names: PP905, SH3D20, SH3P20, CAMGAP1
ARHGAP27 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 954976
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: GVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPS