AP4M1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089376
Article Name: AP4M1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089376
Supplier Catalog Number: orb2089376
Alternative Catalog Number: BYT-ORB2089376-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP4M1
Conjugation: HRP
Alternative Names: MU-4, CPSQ3, SPG50, MU-ARP2
AP4M1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 004713
UniProt: O00189
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: QELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLS