SOWAHC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089382
Article Name: SOWAHC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089382
Supplier Catalog Number: orb2089382
Alternative Catalog Number: BYT-ORB2089382-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SOWAHC
Conjugation: HRP
Alternative Names: ANKRD57, C2orf26
SOWAHC Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 075392
UniProt: Q53LP3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: TYKLSHALEDGGDHHHHHHSAEGWVGGKAKDPGRKASGSSSGRIKPRLNK