UQCRQ Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089411
Article Name: UQCRQ Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089411
Supplier Catalog Number: orb2089411
Alternative Catalog Number: BYT-ORB2089411-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human UQCRQ
Conjugation: Biotin
Alternative Names: QPC, QCR8, QP-C, UQCR7, MC3DN4
UQCRQ Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 055217
UniProt: O14949
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK