THOC7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089420
Article Name: THOC7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089420
Supplier Catalog Number: orb2089420
Alternative Catalog Number: BYT-ORB2089420-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human THOC7
Conjugation: Biotin
Alternative Names: fSAP24, hTREX30, NIF3L1BP1
THOC7 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 079351
UniProt: Q6I9Y2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP