STK35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089438
Article Name: STK35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089438
Supplier Catalog Number: orb2089438
Alternative Catalog Number: BYT-ORB2089438-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human STK35
Conjugation: Biotin
Alternative Names: CLIK1, STK35L1
STK35 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 543026
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LENPKMELHIPQKRRTSMSEGIKQLLKDMLAANPQDRPDAFELETRMDQV