RPS4Y2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089501
Article Name: RPS4Y2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089501
Supplier Catalog Number: orb2089501
Alternative Catalog Number: BYT-ORB2089501-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPS4Y2
Conjugation: Biotin
Alternative Names: RPS4Y2P
RPS4Y2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 001034656
UniProt: Q8TD47
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TGKITSFIKFDTGNVCMVIAGANLGRVGVITNRERHPGSCDVVHVKDANG