Gm13194 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089510
Article Name: Gm13194 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089510
Supplier Catalog Number: orb2089510
Alternative Catalog Number: BYT-ORB2089510-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Gm13194
Conjugation: Biotin
Alternative Names: OTTMUSG00000010821
Gm13194 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 355309
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DSLYAQRKRRYDRKRSGYGGQTKPIFCKKAKTTKKIVLTLECVEPNCRSK