PPP1R9A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089540
Article Name: PPP1R9A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089540
Supplier Catalog Number: orb2089540
Alternative Catalog Number: BYT-ORB2089540-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PPP1R9A
Conjugation: Biotin
Alternative Names: NRB1, NRBI, Neurabin-I
PPP1R9A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 151kDa
NCBI: 001159632
UniProt: B2RWQ1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGEGSQQSRGR