PPFIBP2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089545
Article Name: PPFIBP2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089545
Supplier Catalog Number: orb2089545
Alternative Catalog Number: BYT-ORB2089545-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPFIBP2
Conjugation: FITC
Alternative Names: Cclp1
PPFIBP2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 98kDa
NCBI: 003612
UniProt: Q8ND30
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKREKMASPAYTPLTTTA