PPEF2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089548
Article Name: PPEF2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089548
Supplier Catalog Number: orb2089548
Alternative Catalog Number: BYT-ORB2089548-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPEF2
Conjugation: FITC
Alternative Names: PPP7CB
PPEF2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 006230
UniProt: O14830
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LVTGEKEEPSRSASEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKA