PIH1D1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089559
Article Name: PIH1D1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089559
Supplier Catalog Number: orb2089559
Alternative Catalog Number: BYT-ORB2089559-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PIH1D1
Conjugation: HRP
Alternative Names: Pih1, MOT48, NOP17, DNAAF14
PIH1D1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 060386
UniProt: Q9NWS0
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: GLSLEIGENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLMVAM