OR52A1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089577
Article Name: OR52A1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089577
Supplier Catalog Number: orb2089577
Alternative Catalog Number: BYT-ORB2089577-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52A1
Conjugation: HRP
Alternative Names: HPFH1OR
OR52A1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 036507
UniProt: Q9UKL2
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: IQIFITVFRLPQKEARFKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHI