OR7D4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089583
Article Name: OR7D4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089583
Supplier Catalog Number: orb2089583
Alternative Catalog Number: BYT-ORB2089583-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR7D4
Conjugation: HRP
Alternative Names: OR19B, hg105, OR19-7, OR19-B, OR7D4P
OR7D4 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 001005191
UniProt: Q8NG98
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: GVYLSSAVTHSSQSSSTASVMYAMVTPMLNPFIYSLRNKDVKGALERLLS