OR7D4 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089584
Article Name: OR7D4 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089584
Supplier Catalog Number: orb2089584
Alternative Catalog Number: BYT-ORB2089584-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR7D4
Conjugation: FITC
Alternative Names: OR19B, hg105, OR19-7, OR19-B, OR7D4P
OR7D4 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 001005191
UniProt: Q8NG98
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GVYLSSAVTHSSQSSSTASVMYAMVTPMLNPFIYSLRNKDVKGALERLLS