Naaladl2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2089599
| Article Name: |
Naaladl2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2089599 |
| Supplier Catalog Number: |
orb2089599 |
| Alternative Catalog Number: |
BYT-ORB2089599-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Naaladl2 |
| Conjugation: |
FITC |
| Alternative Names: |
Gm1021, EG635702, 2810043G22Rik |
| Naaladl2 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
38kDa |
| NCBI: |
915927 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: SLKGNEPSVPHLLALASRLRESAELFQSDEMRPANDPKERAPSRVRMLND |
