MTERF2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089607
Article Name: MTERF2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089607
Supplier Catalog Number: orb2089607
Alternative Catalog Number: BYT-ORB2089607-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MTERFD3
Conjugation: HRP
Alternative Names: mTERFL, MTERFD3
MTERF2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 079474
UniProt: Q49AM1
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: TAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQEL