KIF24 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089647
Article Name: KIF24 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089647
Supplier Catalog Number: orb2089647
Alternative Catalog Number: BYT-ORB2089647-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KIF24
Conjugation: FITC
Alternative Names: C9orf48, bA571F15.4
KIF24 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 140kDa
NCBI: 919289
UniProt: Q5T7B8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IRQNTSEKQNPWTEMEKIRVCVRKRPLGMREVRRGEINIITVEDKETLLV