KDELC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089651
Article Name: KDELC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089651
Supplier Catalog Number: orb2089651
Alternative Catalog Number: BYT-ORB2089651-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KDELC2
Conjugation: Biotin
Alternative Names: KDELC2
KDELC2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 714916
UniProt: Q7Z4H8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SWINKTERAFFRGRDSREERLQLVQLSKENPQLLDAGITGYFFFQEKEKE