ISOC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089654
Article Name: ISOC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089654
Supplier Catalog Number: orb2089654
Alternative Catalog Number: BYT-ORB2089654-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ISOC1
Conjugation: Biotin
Alternative Names: CGI-111
ISOC1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 057132
UniProt: Q96CN7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV