INTU Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089658
Article Name: INTU Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089658
Supplier Catalog Number: orb2089658
Alternative Catalog Number: BYT-ORB2089658-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human INTU
Conjugation: HRP
Alternative Names: INT, OFD17, PDZD6, PDZK6, SRTD20, CPLANE4
INTU Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 104kDa
NCBI: 056508
UniProt: Q9ULD6
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: TLEEVAQLSGSIHPQLIKNFHQCCLSIRAVFQQTLVEEKKKGLNSGDHSD