INTU Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089659
Article Name: INTU Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089659
Supplier Catalog Number: orb2089659
Alternative Catalog Number: BYT-ORB2089659-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human INTU
Conjugation: FITC
Alternative Names: INT, OFD17, PDZD6, PDZK6, SRTD20, CPLANE4
INTU Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 104kDa
NCBI: 056508
UniProt: Q9ULD6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TLEEVAQLSGSIHPQLIKNFHQCCLSIRAVFQQTLVEEKKKGLNSGDHSD