IGFBPL1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2089662
| Article Name: |
IGFBPL1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2089662 |
| Supplier Catalog Number: |
orb2089662 |
| Alternative Catalog Number: |
BYT-ORB2089662-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IGFBPL1 |
| Conjugation: |
FITC |
| Alternative Names: |
IGFBPRP4, IGFBP-RP4, bA113O24.1 |
| IGFBPL1 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
26kDa |
| NCBI: |
001007564 |
| UniProt: |
Q8WX77 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: WRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKED |
