HACL1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089665
Article Name: HACL1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089665
Supplier Catalog Number: orb2089665
Alternative Catalog Number: BYT-ORB2089665-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HACL1
Conjugation: FITC
Alternative Names: HPCL, HPCL2, PHYH2, 2-HPCL
HACL1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 036392
UniProt: Q9UJ83
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CWPLLVIGGSSERNQETMGAFQEFPQVEACRLYTKFSARPSSIEAIPFVI