GPRIN2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089674
Article Name: GPRIN2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089674
Supplier Catalog Number: orb2089674
Alternative Catalog Number: BYT-ORB2089674-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPRIN2
Conjugation: FITC
Alternative Names: GRIN2, KIAA0514
GPRIN2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 055511
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPE