ADGRG5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089685
Article Name: ADGRG5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089685
Supplier Catalog Number: orb2089685
Alternative Catalog Number: BYT-ORB2089685-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GPR114
Conjugation: HRP
Alternative Names: PGR27, GPR114
ADGRG5 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 722579
UniProt: Q8IZF4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: WSPEGCRTEQPSHSQVLCRCNHLTYFAVLMQLSPALVPAELLAPLTYISL