GPR21 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089692
Article Name: GPR21 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089692
Supplier Catalog Number: orb2089692
Alternative Catalog Number: BYT-ORB2089692-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR21
Conjugation: FITC
GPR21 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 005285
UniProt: Q99679
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FRICQQHTKDISERQARFSSQSGETGEVQACPDKRYAMVLFRITSVFYIL