GPR21 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089694
Article Name: GPR21 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089694
Supplier Catalog Number: orb2089694
Alternative Catalog Number: BYT-ORB2089694-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR21
Conjugation: HRP
GPR21 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 005285
UniProt: Q99679
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MMLYAPAALIVCFTYFNIFRICQQHTKDISERQARFSSQSGETGEVQACP