GMCL1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089698
Article Name: GMCL1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089698
Supplier Catalog Number: orb2089698
Alternative Catalog Number: BYT-ORB2089698-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GMCL1
Conjugation: FITC
Alternative Names: GCL, GCL1, BTBD13, SPATA29
GMCL1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 848526
UniProt: Q96IK5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HGFCYCAGSHKRKRSSGSFCYCHPDSETDEDEEEGDEQQRLLNTPRRKKL