GMCL1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2089700
Article Name: GMCL1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089700
Supplier Catalog Number: orb2089700
Alternative Catalog Number: BYT-ORB2089700-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GMCL1
Conjugation: HRP
Alternative Names: GCL, GCL1, BTBD13, SPATA29
GMCL1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 848526
UniProt: Q96IK5
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: QWFAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGEYCWRWTGFNF