FKBP9 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089704
Article Name: FKBP9 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089704
Supplier Catalog Number: orb2089704
Alternative Catalog Number: BYT-ORB2089704-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FKBP9
Conjugation: FITC
Alternative Names: FKBP60, FKBP63, PPIase
FKBP9 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 009201
UniProt: O95302
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL