EPS8L3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2089710
Article Name: EPS8L3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089710
Supplier Catalog Number: orb2089710
Alternative Catalog Number: BYT-ORB2089710-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EPS8L3
Conjugation: FITC
Alternative Names: HYPT5, EPS8R3
EPS8L3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 61kDa
UniProt: Q8TE67
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LFMGKLEKAQAKTSRKKKFGKKNKDQGGLTQAQYIDCFQKIKHSFNLLGR