DNAJC8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089723
Article Name: DNAJC8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089723
Supplier Catalog Number: orb2089723
Alternative Catalog Number: BYT-ORB2089723-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DNAJC8
Conjugation: Biotin
Alternative Names: SPF31, HSPC331
DNAJC8 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 055095
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: REEEIEAQEKAKREREWQKNFEESRDGRVDSWRNFQANTKGKKEKKNRTF