ARSJ Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2089780
Article Name: ARSJ Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2089780
Supplier Catalog Number: orb2089780
Alternative Catalog Number: BYT-ORB2089780-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARSJ
Conjugation: Biotin
Alternative Names: ASJ
ARSJ Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 078866
UniProt: Q5FYB0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VWGPWYKEETKKKKPSKNQAEKKQKKSKKKKKKQQKAVSGSTCHSGVTCG