TAAR2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2090114
Article Name: TAAR2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090114
Supplier Catalog Number: orb2090114
Alternative Catalog Number: BYT-ORB2090114-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR2
Conjugation: HRP
Alternative Names: GPR58, taR-2
TAAR2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 055441
UniProt: Q9P1P5
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: ENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLF