CDV3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2090302
Article Name: CDV3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090302
Supplier Catalog Number: orb2090302
Alternative Catalog Number: BYT-ORB2090302-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CDV3
Conjugation: Biotin
Alternative Names: H41
CDV3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 23kDa
UniProt: Q9UKY7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEEGGGGGGGMEKS