Akirin2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2090329
Article Name: Akirin2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2090329
Supplier Catalog Number: orb2090329
Alternative Catalog Number: BYT-ORB2090329-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Akirin2
Conjugation: Biotin
Alternative Names: AA114675, AA522011, AU019887, Akirin-2, 2700059D21Rik
Akirin2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 001007590
UniProt: B1AXD8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY